Protein Info for PGA1_c21420 in Phaeobacter inhibens DSM 17395

Annotation: prolyl-tRNA synthetase ProS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to SYP_RUEST: Proline--tRNA ligase (proS) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 89% identity to sit:TM1040_1852)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), bacterial type" (EC 6.1.1.15)

MetaCyc Pathways

tRNA charging (19/21 steps found)
pyoluteorin biosynthesis (1/7 steps found)
ergotamine biosynthesis (4/12 steps found)
(2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)
clorobiocin biosynthesis (1/10 steps found)
superpathway of ergotamine biosynthesis (5/18 steps found)
pyrrolomycin biosynthesis (1/14 steps found)
sulfazecin biosynthesis (1/16 steps found)
phosalacine biosynthesis (2/25 steps found)
phosphinothricin tripeptide biosynthesis (2/25 steps found)
colibactin biosynthesis (6/38 steps found)

KEGG Metabolic Maps

Aminoacyl-tRNA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY80 at UniProt or InterPro

Protein Sequence (451 amino acids)

>PGA1_c21420 prolyl-tRNA synthetase ProS (Phaeobacter inhibens DSM 17395)
MRLSRYFLPVLKENPSEAQIVSHRYMLRAGMIKQSAAGIYSWLPLGFKVLKKIETIVHEE
QMRAGHIPMLMPTLQSADLWKESGRYDDYGQEMLRISDRHGRDMLYGPTNEELITDIFRS
HVGSYKDLPLTLYHIQWKFRDEIRPRFGVMRGREFYMKDGYNFDLTKEDALHAYNRHLVS
YLRSYERMGLQAIPMRADGGPIGGDYTHEFLVLADTGESEVFYDSAVTDLTFGDRAIDYD
SVEQCQGVLEEFTSKYARTDETHDEALFNEVPEERRRVARGIEVGQIFYFGTKYSEALGA
NVQGPDGKQSPVHMGSHGIGVSRLLGAIIEASHDDKGIIWPEGVTPFHCGIVNLKQGDDE
ADAACESLYEALTAAGLEPLYDDRKERAGGKFATMDLIGLPWRITVGPRGLKNGVVELTS
RRSGESEELSPEAAVQKIVEIYANHQTGRGF