Protein Info for Psest_2149 in Pseudomonas stutzeri RCH2

Annotation: Ku protein, prokaryotic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02772: Ku protein" amino acids 3 to 262 (260 residues), 330.4 bits, see alignment E=3.9e-103 PF02735: Ku" amino acids 11 to 193 (183 residues), 166.7 bits, see alignment E=3e-53

Best Hits

Swiss-Prot: 60% identical to KU_PSESM: Non-homologous end joining protein Ku (ku) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 96% identity to psa:PST_2162)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIW9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Psest_2149 Ku protein, prokaryotic (Pseudomonas stutzeri RCH2)
MPRTIWKGAVSFGLVHIPVALVPATTRQGIDFDWLDKRSMDRVGYKRINKTTGEDIDSEN
IVKGVEYEKGSYVVISDDEIKSAHPKATQTVDIVAFVDAKDISFLYIDTPYYLTPDRRGE
KVYALLRETLIQTGKVGIANVVLRNKQHLAVVMPLGKALVMNTLRWADEVRGVEYLELKD
EALDPDLAERELDMAKRLVEDMTEKWKPEQYKDTFQDQIMELVEKKAREGKLEAVGGPEE
AVDRRSADVIDLTELLKRSLAAKPGKARAASEDDEADDAPKKAPAKPKTTSKA