Protein Info for HP15_2059 in Marinobacter adhaerens HP15

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 52 to 74 (23 residues), see Phobius details TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 15 to 339 (325 residues), 230.4 bits, see alignment E=1.4e-72 PF01565: FAD_binding_4" amino acids 26 to 158 (133 residues), 76.3 bits, see alignment E=2e-25 PF02873: MurB_C" amino acids 218 to 340 (123 residues), 97.2 bits, see alignment E=5.6e-32

Best Hits

Swiss-Prot: 46% identical to MURB_PSEPF: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 67% identity to maq:Maqu_1736)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRB4 at UniProt or InterPro

Protein Sequence (348 amino acids)

>HP15_2059 UDP-N-acetylenolpyruvoylglucosamine reductase (Marinobacter adhaerens HP15)
MSQQPEIRENIELEALNTLHVPAKARFYVEVHTSDELVRSLDWASSEDQEVLILGGGSNL
VFAGDFAGLVVRLAIRGRRWEHIEGHRATLVLGAGENWHEAVLYAARAGYRGIENLALIP
GTAGAAPVQNIGAYGVELGDSLESVTALDRNSGELVVLDNAQCRFSYRDSLFKQTPGRYV
ITEIRLGLSRSRALVLGYRDLREYLGDTAETALDPLHVAEAVMAIRRRKLPDPDMIPNAG
SFFKNPVVDGETFEVLSERHPDIVAYPQEQGVKLAAAWLIDQSGWKGFRNARVGVHNRQA
LVLINHSGGTGADILELAREVRQSVVDRFGVTLEMEPGIVGGSGRENP