Protein Info for PGA1_c02130 in Phaeobacter inhibens DSM 17395

Annotation: conserved hypothetical protein YidD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF01809: YidD" amino acids 7 to 71 (65 residues), 96.7 bits, see alignment E=2.7e-32 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 12 to 79 (68 residues), 85 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 80% identical to YIDD_RHOS5: Putative membrane protein insertion efficiency factor (Rsph17025_0068) from Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

KEGG orthology group: K08998, hypothetical protein (inferred from 90% identity to sil:SPO0536)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLE0 at UniProt or InterPro

Protein Sequence (90 amino acids)

>PGA1_c02130 conserved hypothetical protein YidD (Phaeobacter inhibens DSM 17395)
MTPLAHLFALPVRAYRLLFSPWVGFNCRYQPTCSAYALEALEKHGAIRGAWLTARRIGRC
HPLGGDGYDPVPGCDPEHDRRTRDTATGDK