Protein Info for HP15_2042 in Marinobacter adhaerens HP15

Annotation: crossover junction endodeoxyribonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF02075: RuvC" amino acids 4 to 150 (147 residues), 207.2 bits, see alignment E=5.5e-66 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 4 to 157 (154 residues), 214.7 bits, see alignment E=3.2e-68

Best Hits

Swiss-Prot: 90% identical to RUVC_MARHV: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 90% identity to maq:Maqu_1706)

MetaCyc: 59% identical to crossover junction endodeoxyribonuclease RuvC (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10 or 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQT6 at UniProt or InterPro

Protein Sequence (175 amino acids)

>HP15_2042 crossover junction endodeoxyribonuclease RuvC (Marinobacter adhaerens HP15)
MAIILGVDPGSRITGYGVIRADGRHIEYIDSGCIRVGEKPMAERLQTIFQSLATLIGEYR
PEEFAIEQVFMARNPDSALKLGQARGAAIVSAANSGLAVHEYSARQVKQAVVGKGGADKS
QVQHMVQVLLSLSRKPQADAADALAIAMCHAHMSQSILRVASGAGKVRSGRVRQQ