Protein Info for HP15_2041 in Marinobacter adhaerens HP15

Annotation: Holliday junction ATP-dependent DNA helicase RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 79.6 bits, see alignment E=3e-26 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 207 (207 residues), 175.7 bits, see alignment E=3.8e-56 PF14520: HHH_5" amino acids 72 to 127 (56 residues), 47 bits, see alignment E=5.7e-16 PF07499: RuvA_C" amino acids 163 to 206 (44 residues), 62 bits, see alignment 1.2e-20

Best Hits

Swiss-Prot: 84% identical to RUVA_MARHV: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 84% identity to maq:Maqu_1705)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQT5 at UniProt or InterPro

Protein Sequence (209 amino acids)

>HP15_2041 Holliday junction ATP-dependent DNA helicase RuvA (Marinobacter adhaerens HP15)
MIGRIRGILVEKAPGQALVECAGLGYEVDIPYTTFFHLPETGDEVTLHTHFAVREDAQSL
YGFASSLDRDLFRLLIKVNGVGPKLAVGILSGLDAQQFIRCVENRDSASLVKLPGVGKKT
AERLLIEMADRIGQLEGQFVPTSPEATGVGQPGGQGPAGGPVATEEAEAALIALGYKPQE
AAKAISKVAEEGMSSETLIRLALRNMIPA