Protein Info for Psest_2129 in Pseudomonas stutzeri RCH2

Annotation: ABC-type phosphate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF12727: PBP_like" amino acids 88 to 248 (161 residues), 28.3 bits, see alignment E=1.9e-10 PF13531: SBP_bac_11" amino acids 93 to 315 (223 residues), 25.6 bits, see alignment E=2e-09 PF12849: PBP_like_2" amino acids 93 to 303 (211 residues), 98 bits, see alignment E=1.7e-31 PF00691: OmpA" amino acids 350 to 445 (96 residues), 58.4 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 91% identity to psa:PST_2187)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIU9 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psest_2129 ABC-type phosphate transport system, periplasmic component (Pseudomonas stutzeri RCH2)
MKPGLIGRLRKRALPLLLLAAANGSFAALPVPTDAAAVLRVHGSNTVGAKLAPMLIAGLF
EAEGFQDIGIHPTEVENEQRVSARTPQGKQVYATVAAHGTGTGFAGLKNGQGDLAAASRP
IKTGERAELVDLGDMRSAKAEQVIAIDGLAIVVHPNNAVDSLTTAQLAGLFAGEIRNWRE
LGGPDLPVRLHARDDRSGTYDTFNELVLARQGKALWSDARRYESNDELSRAVTLDAGAIG
FTGLASLGKAKALAIADGDSQPMLPSRALVATEDYPLSRRLFLYAHPRKQSPWTEAYIEF
IHSRAGQSIVERSGYVAQHVEAIRQTALVDMPVFYQQLASEAQRLTVNFRFEEGSAQLDN
KAQRDLARVAEYLRVNGKLTDSAALVGFGDATGDPARAALLSKLRAMTVRRELNKRGVFL
KEINGMGSELPVASNDAGSGRVKNRRVEVWVY