Protein Info for HP15_2040 in Marinobacter adhaerens HP15

Annotation: Holliday junction ATP-dependent DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF05496: RuvB_N" amino acids 27 to 185 (159 residues), 275.7 bits, see alignment E=4.1e-86 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 32 to 333 (302 residues), 492.5 bits, see alignment E=2.1e-152 PF07728: AAA_5" amino acids 61 to 179 (119 residues), 30.9 bits, see alignment E=9.8e-11 PF00004: AAA" amino acids 62 to 185 (124 residues), 75.5 bits, see alignment E=2.3e-24 PF17864: AAA_lid_4" amino acids 188 to 261 (74 residues), 108.7 bits, see alignment E=3.9e-35 PF05491: WHD_RuvB" amino acids 263 to 332 (70 residues), 81.6 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 95% identical to RUVB_MARHV: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 95% identity to maq:Maqu_1704)

MetaCyc: 76% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQT4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>HP15_2040 Holliday junction ATP-dependent DNA helicase RuvB (Marinobacter adhaerens HP15)
MGDAMIESDRLISARAGEYEEVQDRAIRPTLLAEYVGQPTVREQMDIFISAARGRQEALD
HVLIFGPPGLGKTTLANIIANEMGVSIKTTSGPVLEKAGDLAAMLTNLEEGDVLFIDEIH
RLSAAVEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGLLTSPLRDRFG
IVQRLEFYNTEDLTSIILRSARLSSVAVDEAGAFEIARRSRGTPRIANRLLRRVRDFAEV
RSDGRITSDIADQALNMLKVDNQGFDHMDRRLLLAMIEKFDGGPVGVESLAAAISEERGT
IEDVLEPFLIQQGYMVRTPRGRMVTSNAYQHFGVIPPKSGREDDLFG