Protein Info for PGA1_c21170 in Phaeobacter inhibens DSM 17395

Annotation: dihydrofolate reductase FolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00186: DHFR_1" amino acids 1 to 146 (146 residues), 152.1 bits, see alignment E=5.3e-49

Best Hits

Swiss-Prot: 39% identical to DYR2_HALMA: Dihydrofolate reductase 2 (folA2) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 67% identity to sit:TM1040_1728)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY62 at UniProt or InterPro

Protein Sequence (158 amino acids)

>PGA1_c21170 dihydrofolate reductase FolA (Phaeobacter inhibens DSM 17395)
MITLIVARDQNGAIGKDNTIPWHAPEDLQSFQRETLGGALIMGRNTWDSLPVKPLKNRLN
LVVSSDPEAADLVYPSIEAALAEARAQGYHRIYGIGGAGIYKGMMEGADRMLITEVETEV
EGADTYFPKFRAGEWGIASQTEIRSEAPACVVVEYLRR