Protein Info for PGA1_c21150 in Phaeobacter inhibens DSM 17395

Annotation: Asp/Glu/hydantoin racemase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17645: Amdase
  • amino acids 122 to 253 (132 residues), 90.4 bits, E=7.2e-30

Best Hits

KEGG orthology group: K01799, maleate isomerase [EC: 5.2.1.1] (inferred from 49% identity to bph:Bphy_7794)

Predicted SEED Role

"Putative decarboxylase"

MetaCyc Pathways

• nicotinate degradation II (1/5 steps found)
• nicotinate degradation I (1/6 steps found)
• picolinate degradation (1/7 steps found)
• nicotine degradation III (VPP pathway) (2/10 steps found)
• nicotine degradation II (pyrrolidine pathway) (2/11 steps found)
• superpathway of nicotinate degradation (2/18 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.2.1.1

Sequence Analysis Tools

See I7F0M7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PGA1_c21150 Asp/Glu/hydantoin racemase-like protein (Phaeobacter inhibens DSM 17395)
MFRSGQTVQSRPRTPLMGKGTAHRASLGFILMSTDLACEADLFAMAPDGVGVHITRLKTD
DYTTNETLARHIDHMADAAGRLQPDMRPAVIAYCCTSGSIVCREENVFREIHKGAPYTQP
MSIVTGVMDALREVGAKQIVVGTPYLDDINTAEAEYLLAAGFDILDIQGLRLETGMEFGQ
VEPAYWKEFALEIDQPDADAIFLSCSGTRTLEVVEEIEQAAGKPVITSNQALMWSCLRRA
GIADHLDGFGQLFKHPGRALTPTL