Protein Info for HP15_2035 in Marinobacter adhaerens HP15

Annotation: translocation protein TolB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 22 to 433 (412 residues), 473.9 bits, see alignment E=2.3e-146 PF04052: TolB_N" amino acids 32 to 133 (102 residues), 95 bits, see alignment E=5.9e-31 PF07676: PD40" amino acids 204 to 234 (31 residues), 32.8 bits, see alignment (E = 1e-11) amino acids 244 to 278 (35 residues), 25.6 bits, see alignment 1.8e-09 amino acids 286 to 321 (36 residues), 34.4 bits, see alignment 3.1e-12 amino acids 330 to 359 (30 residues), 13.6 bits, see alignment (E = 1.1e-05) amino acids 377 to 404 (28 residues), 18.5 bits, see alignment (E = 3.2e-07) PF00930: DPPIV_N" amino acids 282 to 397 (116 residues), 22.2 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 53% identical to TOLB_HAHCH: Tol-Pal system protein TolB (tolB) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K03641, TolB protein (inferred from 80% identity to maq:Maqu_1699)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQS9 at UniProt or InterPro

Protein Sequence (437 amino acids)

>HP15_2035 translocation protein TolB precursor (Marinobacter adhaerens HP15)
MTHRIWHKPSRTLLAATALIFFAVSAARAELLIRITEGADSAIPVAVVPFAESGQMPAGD
KVSSIVQADLTMTGEFRTLPPEKMLSLPSRREEVYFRDWRLLGQRYVLVGALSRSGDRVQ
ARYELFDVNREERILGETAAAPASNMRSLAHHISDKVYEAITGVPGAFSTKLAYITLDTA
NGKPRYRLQVSDVDGKRARIRLESQEPILSPAWSPDGEKLAYVSFETGKPVIFVHELATG
NRTKVADFPGLNSAPAWSDDGRSLLMTLSKDGNAEIYRMNLDTRQLTKLTNHWAIDTEPS
YDATGKGIFFTSDRSGGPQIYHMDTPGAEPRRITFGSRYNARPRPDNDGNYVYYVHQRDR
AFHIARTELKTGEETILTRTESDESPSVAPNGRMLIYATRQNGSNVLTVISADGGAAYSL
PASEGDVREPAWGPLVR