Protein Info for Psest_2123 in Pseudomonas stutzeri RCH2

Updated annotation (from data): fusion of gluconokinase (EC 2.7.1.12) and the small permease component of the D-gluconate TRAP transporter
Rationale: This protein has pleiotropic phenotypes which are not explained, but it is most important for fitness with D-gluconate as the carbon source, consistent with its putative roles as part of the tripartite gluconate transport system and as gluconate kinase. Also, the N-terminal part is 49% identical to PP3416 or gnuK from P. putida, which is the catabolic gluconate kinase (PMC1951859). The SEED and KEGG annotations ignore the dctQ-like C-terminal portion.
Original annotation: carbohydrate kinase, thermoresistant glucokinase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 70 to 94 (25 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 274 (18 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details PF13671: AAA_33" amino acids 14 to 131 (118 residues), 34.6 bits, see alignment E=2.3e-12 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 15 to 174 (160 residues), 174.5 bits, see alignment E=7.5e-56 PF04290: DctQ" amino acids 232 to 362 (131 residues), 90.9 bits, see alignment E=6.5e-30

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 90% identity to psa:PST_2201)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLK1 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Psest_2123 fusion of gluconokinase (EC 2.7.1.12) and the small permease component of the D-gluconate TRAP transporter (Pseudomonas stutzeri RCH2)
MPSVHTSKASALPVLVVMGVSGSGKTETSHAVADALGLPHIEADNFHPAENVARMRAGTP
LSDADRMEWLHALIAEMQRTLAAGSGFVLACSALKRSYRELLRSAVPELRFAHLAIDYET
AVQRVGGRAGHFMPISLVDSQFATLESPEGEPGVLTVDASQPREGVLRQIVEWMQGSGLD
ELIETRVDLSSRPFDSATTAPPLTNEPIYSGRVAQHFDRLTDWLMAALMAFMVIVVFSSV
VLRYAFGTGWTGAEELSRLAFVWLVFVGVASSMRRGELMSFSMLRDRFPRLFRRVVDSLS
WLLVAAASCLAAWGGWNQMQFGWTINSPVVGYPLGLAMLPVAASMVALAVLALLQLVNVW
RRDQPSATAAANVTAD