Protein Info for Psest_0209 in Pseudomonas stutzeri RCH2

Annotation: membrane protein AbrB duplication

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 114 to 128 (15 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 223 to 223 (1 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 8 to 161 (154 residues), 123.2 bits, see alignment E=4.3e-40 amino acids 180 to 334 (155 residues), 120.5 bits, see alignment E=2.8e-39 PF05145: AbrB" amino acids 31 to 335 (305 residues), 272.9 bits, see alignment E=1.5e-85

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 97% identity to psa:PST_4037)

Predicted SEED Role

"Ammonia monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHC6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Psest_0209 membrane protein AbrB duplication (Pseudomonas stutzeri RCH2)
MRQRLPAWWATPLIGALGGWLASFANWPLPWMVGSLLAVIAVRCSGWLVSEVPRGRQVGQ
WIVASAIGLHFTGEVMREVLAHFGVILAGAVGTLLLGLIGIVILLRSGTDRATAFFASMP
GGASEMVVLANRHRAEAASVAAAHSLRLLLVVLIVPALFTWGLPTVAAPPAAPVSWPWLT
VLLPGGGLLALLWKRLGQPNPWMLGPLTACALASVAFDLHIGLPGWAGALGQWLIGCSLA
CHFDRPFFRSAPAFLLRILLFTLLAMLVAAALGGALGWLTALDEVSLMLGMMPGGITELC
LTAEALQLSVALVTAVQVLRLFLVMFLAEPLFRAWQRRSPPR