Protein Info for HP15_2032 in Marinobacter adhaerens HP15

Annotation: quinolinate synthetase complex, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 29 to 342 (314 residues), 387.8 bits, see alignment E=1.8e-120 PF02445: NadA" amino acids 34 to 340 (307 residues), 368.6 bits, see alignment E=1.1e-114

Best Hits

Swiss-Prot: 92% identical to NADA_MARHV: Quinolinate synthase A (nadA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 92% identity to maq:Maqu_1696)

MetaCyc: 70% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQS6 at UniProt or InterPro

Protein Sequence (353 amino acids)

>HP15_2032 quinolinate synthetase complex, A subunit (Marinobacter adhaerens HP15)
MTYAEDRILVQEHLAHAAEPKPLSADEKSDLEARIKSALKEQDAVLVAHYYTDPDIQRLA
EETGGCVADSLEMARFGNQHSASTIVVAGVRFMGETAKILNPEKRVLMPTLEATCSLDVG
CPADEFAEFCDQHPDRTVVVYANTSAAVKARADWVVTSSCAQAIVEDLDARGEKILWAPD
KHLGHYVQKTTGADMLLWDGSCIVHEEFKSRGLEDLKALYPDAAVLVHPESPDAVVEMAD
VVGSTSQLIHAVQTMPNEKFIVATDNGIFYKMQQLAPNKTLIEAPTAGNGATCRSCAHCP
WMAMNGLQNLLQVLERGDQEVFVDPELREKALQPLQRMLDFTANMNLKAAGNA