Protein Info for HP15_2027 in Marinobacter adhaerens HP15

Annotation: dihydrodipicolinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00701: DHDPS" amino acids 2 to 287 (286 residues), 339.6 bits, see alignment E=5.3e-106 TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase" amino acids 5 to 287 (283 residues), 347.8 bits, see alignment E=1.6e-108

Best Hits

Swiss-Prot: 94% identical to DAPA_MARHV: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 94% identity to maq:Maqu_1691)

MetaCyc: 51% identical to 4-hydroxy-tetrahydrodipicolinate synthase (Escherichia coli K-12 substr. MG1655)
DIHYDRODIPICSYN-RXN [EC: 4.3.3.7]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQS1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>HP15_2027 dihydrodipicolinate synthase (Marinobacter adhaerens HP15)
MITGSLVALVTPMHPNGDIHWEDLDKLVDFHIENGTHGIVAVGTTGESATLDPEEHCQTI
GHIIKRVNGRIPVIAGTGGNSTREAIELTAEAHKLGADACLLVVPYYNKPTQEGLYQHFK
AIAEAVPGMNQMLYNVPGRTACDMLNETVLRLADIPNIVGIKDATGNIPRGAELIEALDG
RLAVYSGDDATAAELMLAGAKGNVSVTANVAPKAMSQLCEAAVAGNREETERLNELLMPL
NRKLFLEANPIPVKWALHHMGMIGEGIRLPLTVLSEKFHGEVEDALKVSGVL