Protein Info for HP15_2024 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, secreted

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR04219: outer membrane protein" amino acids 4 to 245 (242 residues), 229.4 bits, see alignment E=1.8e-72

Best Hits

KEGG orthology group: None (inferred from 34% identity to kko:Kkor_2065)

Predicted SEED Role

"FIG00785325: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQR8 at UniProt or InterPro

Protein Sequence (245 amino acids)

>HP15_2024 conserved hypothetical protein, secreted (Marinobacter adhaerens HP15)
MRKLMLAVGGSLFLVAPVSQADVVGLGASVSYWDSDLSGQAADNGDVVDVENDLNLDSDS
NANASLYLEHPIPVLPNVRLNYTLVQQSGRGQVNGNFGGVNFGGLDVQSDLDLEQLDLTL
YYEVLDNWVNLDLGLTARDLSGELIVKEALTGTPSNETTVDAVIPMGYLAARFDLPLTGV
SVGAEGNFISFDGDSLHDFNAYGQYEISLIQFRAGYRQMSIDYEDGNDRLDVEIGGPFVS
AGVSF