Protein Info for HP15_2021 in Marinobacter adhaerens HP15

Annotation: membrane protein containing DUF606

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details PF04657: DMT_YdcZ" amino acids 7 to 144 (138 residues), 110.4 bits, see alignment E=4.5e-36

Best Hits

KEGG orthology group: K09936, hypothetical protein (inferred from 55% identity to sdn:Sden_0761)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQR5 at UniProt or InterPro

Protein Sequence (154 amino acids)

>HP15_2021 membrane protein containing DUF606 (Marinobacter adhaerens HP15)
MNSSFAYALLMLVAGIGIPVMATLNGGLGARLQSPALAAAILFFVALILAISYLITTEGF
PEKIFPANVPVYFYFGGFFVLFYILTITWVAPRFGISNAIAFVLLGQLIAMSLIDHFGLL
GVQKFTMSLRRLAGLGVMTIGVFLVLNKVPGGAR