Protein Info for Psest_2100 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 150 to 184 (35 residues), see Phobius details amino acids 194 to 210 (17 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 255 to 282 (28 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 12 to 333 (322 residues), 120.2 bits, see alignment E=5.1e-39

Best Hits

Predicted SEED Role

"probable O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMT2 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psest_2100 Predicted acyltransferases (Pseudomonas stutzeri RCH2)
MSDAGARQGKNRNIQFLRGLAIMLVLLAHASVMLVGAEADWWDGLLQRFLPGIGVDLFFL
ISGYLMGATFLRKQQGFEAEAVYAFYKKRIRRVLLPTWFWAAVVLMFSVVEPPRGAPAYS
LDTLLGVTASAAFFLANVFNGLHETDFGYFWSIALEVQFYLLFPLLLLLRRAFWPAVIGI
VLWFSFANPFAPEWLFRVNGLFMGLLLWKLSSLDQFRVVERDIEAMTATAKVLVTGLAVV
SASILAIALEPLASFRWAAATLVLAVPFMLAVCSSEAIFGALSRPLETIGQLSFSLYLCH
IPVWLLCMSLLDDQPLLPRVALCVTMSLIVAGLSYRYIERPLMEGAKSAAAAGEGATASS
IAVARAGRGG