Protein Info for PGA1_c20900 in Phaeobacter inhibens DSM 17395

Annotation: Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF02625: XdhC_CoxI" amino acids 33 to 98 (66 residues), 88.6 bits, see alignment E=2.1e-29 PF13478: XdhC_C" amino acids 190 to 331 (142 residues), 143.8 bits, see alignment E=4.1e-46

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 70% identity to sit:TM1040_1768)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0L3 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PGA1_c20900 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family (Phaeobacter inhibens DSM 17395)
MSTPGLQRFDNIPETALDWHRAEKETGQKSGQKSGRGAALATVVETWGSAPRRTGSQLVV
ASDGRIEGSVSGGCVEGAVILAAQEAIASGRHQILEFGVSDEDAFAVGLACGGTIRILVE
PIGGTLAEDTLADLVTARAERRAVSYVVDLDSGAGHLDAEGYTDRKRMDQSGVEADGKTF
VAVHNPPLRLIVVGAVHIAQALVPMARIAGYDPVIIDPRAAFASADRFPGETLTEDWPDE
AMAQLAPDARTAVVLLTHDPKIDDPALEVALRSECFYIGALGSTRTHAKRVARMQEAGFD
AAAIDRINGPIGLDIGAAGPAEIAVSIIAEMTATLRGRSL