Protein Info for Psest_2097 in Pseudomonas stutzeri RCH2

Annotation: EamA-like transporter family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF00892: EamA" amino acids 34 to 163 (130 residues), 42.1 bits, see alignment E=5.4e-15 amino acids 179 to 319 (141 residues), 30.9 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_2228)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKW1 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Psest_2097 EamA-like transporter family. (Pseudomonas stutzeri RCH2)
MNRSHHPHVHAANTSLDNRAAETHKGESGGTTRAHLGMLLWALFVGLSFPAVGLLSDDLP
PLLLTAMRFAIAALVLAPLAWSQSEGRPGWRTMLLYAGMGLCLAGFFGTMFWAAHRVSAL
SMATLFVSVPLLAYCLGRGLGVEQPAGRLLAILALGASGALGLAWAENGGDFSGMQFGLG
ELGFFFGCVASALYPVLSKWGLANGTLPRQAGLRTFWSLIAGAVLIGLMGFIWERPAALL
RMNLLDLLLVSYLGVFSSAMTFFLQQRATSVLTPGAVTAYSYLVPFVSMLLLFFDQPARM
GVHWLPGSLLVVLAIGLLLRRDRQS