Protein Info for Psest_2094 in Pseudomonas stutzeri RCH2
Annotation: Predicted Fe-S-cluster redox enzyme
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to Y2231_PSEU5: Probable RNA methyltransferase PST_2231 (PST_2231) from Pseudomonas stutzeri (strain A1501)
KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 95% identity to psa:PST_2231)Predicted SEED Role
"Probable RNA methyltransferase PA1839"
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GIR9 at UniProt or InterPro
Protein Sequence (346 amino acids)
>Psest_2094 Predicted Fe-S-cluster redox enzyme (Pseudomonas stutzeri RCH2) MRIPDLQQRLADIGAKPRHIGRMTRAWLKGLPLDVGRRQQQAEDFLPLSVREGLPALNAE IDGLARLRSEHPAADGSARLLVELADGQMVESVLLPRDGLCVSSQVGCAVGCVFCMTGKS GLLRQLGSAEIVAQVALARRFRPVKKVVFMGMGEPAHNLDNVLEAIDLLGTDGGIGHKNL VFSTVGDMRVFERLPQQRVKPALALSLHSTDAALRQALLPRAPQIAPDELVDLGEAYARA TGFPIQYQWTLLKGINDNQDEMDGILRLLKGKYAVMNLIPYNSLEDDEYQRPDGERIVQI VRYLHSRGVLTKVRNSAGQDIDGGCGQLRARAEQALDRKRRVDRGA