Protein Info for PGA1_c20840 in Phaeobacter inhibens DSM 17395

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF05198: IF3_N" amino acids 53 to 122 (70 residues), 121.4 bits, see alignment E=1.5e-39 TIGR00168: translation initiation factor IF-3" amino acids 54 to 214 (161 residues), 233.3 bits, see alignment E=5.9e-74 PF00707: IF3_C" amino acids 129 to 213 (85 residues), 132.3 bits, see alignment E=4.7e-43

Best Hits

Swiss-Prot: 93% identical to IF3_RUEPO: Translation initiation factor IF-3 (infC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 93% identity to sil:SPO2638)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E239 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PGA1_c20840 translation initiation factor IF-3 (Phaeobacter inhibens DSM 17395)
MKTAICAVIPAIDLNRRPGTVIFRALFRSDRRIDVIARRPHNAPPQRDTGPRTNEKIRAP
EIRLIGAEGENVGVVHPAKAMQMAEEAGLDLVEISPNATPPVCKIMDYGKFKYEQQKRES
EARKKQKIIEVKEVKFRPNTDTHDYEVKMRNVYKFLENGDKVKITLRFRGREMAHQNLGR
ELLLRVAEDIKELGKVENMPKMEGRQMIMMIGPLPQK