Protein Info for HP15_1996 in Marinobacter adhaerens HP15

Annotation: phage Gp37Gp68

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 91 to 112 (22 residues), see Phobius details PF07505: DUF5131" amino acids 4 to 355 (352 residues), 332.2 bits, see alignment E=9.6e-104

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQP0 at UniProt or InterPro

Protein Sequence (359 amino acids)

>HP15_1996 phage Gp37Gp68 (Marinobacter adhaerens HP15)
MGQKTGIEWTESTWNPIRGCSRVSEGCRNCYAETVANRFKGPGEPYEGLVAKGGQWNGEV
RLVEHKLDEPCRWSKPRMIFVNSMSDLFHPAVSFETIAGIFGIMAAASWHTFQVLTKRPE
RMMEFFQWIEQHPERKDFDSPQARSQLGEDHWIPFFLAQKASEVLPDSGAGLTVDIKGCW
PLDNLWLGVSVEDQATANERIPQLLETPAAVRWISAEPLLGPIILDEFLFRGDHSLRETD
PLAAAMLAESVADGHGWIRPAIDWVVVGGESGPGARPMHPDWARSLRDRCQAANVPFLFK
QWGEFAPSPDGGLPDELPESAGYYFEDPHPPGKTWRFGKKRAGRTLDGRTWDEYPEPAQ