Protein Info for PGA1_c20720 in Phaeobacter inhibens DSM 17395

Annotation: transporter, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 221 to 246 (26 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF07690: MFS_1" amino acids 138 to 299 (162 residues), 35.3 bits, see alignment E=3.3e-13

Best Hits

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY29 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PGA1_c20720 transporter, MFS family (Phaeobacter inhibens DSM 17395)
MSISPSSAAPVGAVTARLMFLLLLFCGTICTAMIVPFMSYFLVRGLGYEPWIISVYAGMA
ISLTLVANRQFARRIDAGARVFPLVGLAAAGFVCAAGSLALVPALWVVLTAGVIGFGISS
SAVSTMFSLGGSLAERHKVERVRFNAHMRATTSTAWMIGPAVTFLIADGIGLRAVFVMAV
AVSMVWIGLWWFTLPRDITAMPGRATAQDSAGQTAVAPQGLWLAAGFVFCLSSAHSLTFS
ALPIFYVEEVGLPGYAPGFAFSIKTFVEVIAIFSTPWVIARIGMWRALLAVTGLAVVTIQ
LLAAVQSFPQMLAGAALEGLYYGFYASLGISYVQSFAPATPARATAIYWNTLMVSGVMAG
PAVGLIAQAYDFQTVIRCASGVAVFAAAVLIVGRPKKRAVA