Protein Info for PGA1_c20690 in Phaeobacter inhibens DSM 17395

Annotation: C4-dicarboxylate transport transcriptional regulatory protein DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 83.7 bits, see alignment E=2.1e-27 PF00158: Sigma54_activat" amino acids 144 to 203 (60 residues), 27.5 bits, see alignment E=4.7e-10 amino acids 214 to 281 (68 residues), 36.4 bits, see alignment E=8.8e-13 PF14532: Sigma54_activ_2" amino acids 145 to 286 (142 residues), 62.5 bits, see alignment E=1e-20 PF02954: HTH_8" amino acids 362 to 402 (41 residues), 36.4 bits, see alignment 6.8e-13

Best Hits

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 76% identity to sit:TM1040_1814)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E210 at UniProt or InterPro

Protein Sequence (411 amino acids)

>PGA1_c20690 C4-dicarboxylate transport transcriptional regulatory protein DctD (Phaeobacter inhibens DSM 17395)
MINRVLVVDDDAAVRAALGQTLELAECDAITVGSFVAAKDLITPDFDGVILSDMRMPGRD
GFHLLRYVREVDGDLPVILLTGEGDIPMAVQAMGEGAFDFLEKPCASVDLMAVVRRALKT
RALVRENRALKSRLESGDPAARMIFGTSPQMEELRARARGVAATGAEVLVTGAPGGGISK
VAEVIHLMSPRGQGAFVKRPAAGLTPDGFADLCREAAGGSLYLDEIAALPSETQYAMLEA
LEQEQGLEARVLVGSVADLAEEAAQGRFLPDLFYRLDVMRVRIPALSERPEDIPVLFSHY
VAQAAEQAGIAAPDIPQEHLAALMAQDWPGNARSLMSAAMRFVLGMPEEAAQSAELGLAE
QLAQVERSLLIAALGRQNGHASAAAKALKLPRKTFYDKLARYGIRPEDYRR