Protein Info for PGA1_c20680 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): TRAP transporter for fumarate, succinate, L-malate, and 2-oxogulatarate, substrate-binding component
Rationale: Specifically important for utilization of fumarate, succinate, L-malate, and alpha-ketoglutarate. Phenotypes on alpha-ketoglutarate are more mild, which might indicate some genetic redundancy.
Original annotation: C4-dicarboxylate-binding periplasmic protein DctP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 33 to 283 (251 residues), 252.6 bits, see alignment E=2.1e-79 PF03480: DctP" amino acids 33 to 315 (283 residues), 342 bits, see alignment E=1.5e-106

Best Hits

Swiss-Prot: 68% identical to DCTP_VIBCH: C4-dicarboxylate-binding periplasmic protein DctP (dctP) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 87% identity to sit:TM1040_1813)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7END8 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PGA1_c20680 TRAP transporter for fumarate, succinate, L-malate, and 2-oxogulatarate, substrate-binding component (Phaeobacter inhibens DSM 17395)
MKFVTAAATAVALTMSAGTAMAACDDGEIVVKFSHVTNTDKHPKGIAASLLEKRINEEMN
GTMCLEVYPNSTLYNDNKVLEAMLQGDVQLAAPSLSKFEKFTKQFRLFDLPFMFKNIDAV
DAFQGSENGQAMLDSMQRRGLQGLSYWHNGMKQMSANKPLINPSDANGLKFRVQSSDVLV
AQMEAIGGSPQKMAFSEVYGALQQGVVDGQENTWSNIYGKKFFEVQDGVTETNHGALDYL
VVTSVDWLDSLDPAVREQFLTILGEVTATRNSESTKVNAEARQSIIDAGGVVRELTPEQR
AAWVEAMKPVWEQFAGDVGQDMIDAAQAINAGM