Protein Info for PGA1_c20670 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): TRAP transporter for fumarate, succinate, L-malate, and 2-oxogulatarate, small permease component
Rationale: Specifically important for utilization of fumarate, succinate, L-malate, and alpha-ketoglutarate. Phenotypes on alpha-ketoglutarate are more mild, which might indicate some genetic redundancy.
Original annotation: TRAP transporter, subunit DctQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details PF04290: DctQ" amino acids 27 to 118 (92 residues), 79.9 bits, see alignment E=8e-27

Best Hits

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 80% identity to sit:TM1040_1812)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY26 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PGA1_c20670 TRAP transporter for fumarate, succinate, L-malate, and 2-oxogulatarate, small permease component (Phaeobacter inhibens DSM 17395)
MAGAKPGPTGLINTLEETLIALLLGLMTLITFANVVARFVFNSNILWALELTVFLFAWLV
LLGASYAVKVHAHLGVDAILNMVSPGARRVIGLISVGCCLVFSLLLLKGAYDYWAVFADL
PPTSGRWFPTGFDMKARSQSFYEVQDVPMVAIFGFLEDLINYGDSYEKLPKVVPYVVLPL
SMLLMLLRFAQAAMQILRGDVDRLVASHEVEDEIAEVQAQRGEHD