Protein Info for PGA1_c20640 in Phaeobacter inhibens DSM 17395

Annotation: iron-binding protein IscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01521: Fe-S_biosyn
  • amino acids 10 to 109 (100 residues), 83.9 bits, E=4.7e-28
• TIGR00049: iron-sulfur cluster assembly accessory protein
  • amino acids 10 to 112 (103 residues), 116.1 bits, E=4.1e-38

Best Hits

Swiss-Prot: 47% identical to ISCA_HAEIN: Iron-binding protein IscA (iscA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 85% identity to sil:SPO2620)

MetaCyc: 46% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Sequence Analysis Tools

See I7E1Y1 at UniProt or InterPro

Protein Sequence (119 amino acids)

>PGA1_c20640 iron-binding protein IscA (Phaeobacter inhibens DSM 17395)
MFGIPGKQAVTITDKAAAQIAKLMDKGGHSGLRIGVKKGGCAGMEYTMEYVDQPDPNDEV
VEQDGARVLIAPMAQMFLFGTEIDYEVSLLEAGFKFNNPNVSEACGCGESISFKDMPAG