Protein Info for Psest_2073 in Pseudomonas stutzeri RCH2

Annotation: Ribonuclease HI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF00075: RNase_H" amino acids 6 to 142 (137 residues), 177.1 bits, see alignment E=1.1e-56

Best Hits

Swiss-Prot: 95% identical to RNH_PSEU5: Ribonuclease H (rnhA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03469, ribonuclease HI [EC: 3.1.26.4] (inferred from 95% identity to psa:PST_2252)

MetaCyc: 65% identical to ribonuclease HI (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HI (EC 3.1.26.4)" in subsystem Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLF2 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Psest_2073 Ribonuclease HI (Pseudomonas stutzeri RCH2)
MSDDWVEIYTDGACKGNPGPGGWGALLIYKGVKRELWGGEPETTNNRMELMAAISALAEL
KRSCKVRLVTDSQYVMQGINDWMPNWKKRGWKTASKQPVKNADLWQQLDEQVNRHQVSWE
WVRGHTGHPGNEHADLLANRGVVQVKRQPIV