Protein Info for PGA1_c02060 in Phaeobacter inhibens DSM 17395

Annotation: short-chain dehydrogenase / reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00106: adh_short" amino acids 4 to 193 (190 residues), 148.1 bits, see alignment E=3.3e-47 PF01370: Epimerase" amino acids 7 to 104 (98 residues), 22.4 bits, see alignment E=1.1e-08 PF13561: adh_short_C2" amino acids 10 to 238 (229 residues), 169.7 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 60% identical to FIXR_BRADU: Protein FixR (fixR) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 87% identity to sit:TM1040_0302)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWY4 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PGA1_c02060 short-chain dehydrogenase / reductase (Phaeobacter inhibens DSM 17395)
MRKKTLLLTGASRGIGHATVQRFNAEGWRVITCSRQPFPAECPWGGGQENHVQVDLSDPT
DTINKVGEIQELLNGQLDALVNNAGVSPKGPEGERLNTLDTDLMTWGKVFHVNFFASVVL
ARGLKDELAAAKGSVVNVTSIAGSRVHPFAGAAYATSKAALAALTREMAHDFGPLGVRVN
AIAPGEVETAILSPGTDKIVEKLPLQRLGQPEEVAAAIYYLCSDESSYISGAEIEVNGAQ
HV