Protein Info for PGA1_c20520 in Phaeobacter inhibens DSM 17395

Annotation: acetyltransferase and methytransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF13302: Acetyltransf_3" amino acids 33 to 157 (125 residues), 51.6 bits, see alignment E=7.5e-17 PF00583: Acetyltransf_1" amino acids 59 to 156 (98 residues), 28.4 bits, see alignment E=7.7e-10 PF03848: TehB" amino acids 189 to 304 (116 residues), 38.8 bits, see alignment E=3.2e-13 PF05724: TPMT" amino acids 194 to 247 (54 residues), 28.5 bits, see alignment 5.2e-10 PF13489: Methyltransf_23" amino acids 195 to 311 (117 residues), 39.8 bits, see alignment E=1.8e-13 PF13847: Methyltransf_31" amino acids 207 to 326 (120 residues), 47.6 bits, see alignment E=7.1e-16 PF13649: Methyltransf_25" amino acids 210 to 303 (94 residues), 55.5 bits, see alignment E=3.5e-18 PF08242: Methyltransf_12" amino acids 211 to 305 (95 residues), 44.9 bits, see alignment E=7.2e-15 PF08241: Methyltransf_11" amino acids 211 to 307 (97 residues), 43.6 bits, see alignment E=1.8e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DRN6 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PGA1_c20520 acetyltransferase and methytransferase domain-containing protein (Phaeobacter inhibens DSM 17395)
MVREMKFETDRLCIESWDATLGSEQEKQAFAAELAAILTPPVLKSLPEPMQLADGEAAIS
DWIAARHAESHVLAIRDGNASLIGLLILAPSGDAEYPPTVHIGYLFSEITWGKGFASELI
GGLVAWYQDLGEGTQLLAGVAHGNVASAKALQKNGFKQVPDHSDPDTAMFRKDTQFNFDR
LYSSTAHALGAPSSEIVEFFSTLAGNSLRVLDIGCGQGRDALFIARLGHSVVGVDIAPSG
IKDLVAAGNRENLNVDGIVADITNFQPVGQFDVLLIDRTLHLLSVGNRVAVLRRLIGHVA
PQGWVIISDEPENMAAFKEVLDTEEALWKPHMETDEHLMLQHGAG