Protein Info for PGA1_c20500 in Phaeobacter inhibens DSM 17395

Annotation: leucine dehydrogenase Ldh

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF02812: ELFV_dehydrog_N" amino acids 26 to 132 (107 residues), 101.3 bits, see alignment E=3.5e-33 PF00208: ELFV_dehydrog" amino acids 217 to 326 (110 residues), 49.5 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: K00263, leucine dehydrogenase [EC: 1.4.1.9] (inferred from 68% identity to sil:SPO0390)

Predicted SEED Role

"Leucine dehydrogenase (EC 1.4.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.4.1.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E1W3 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PGA1_c20500 leucine dehydrogenase Ldh (Phaeobacter inhibens DSM 17395)
MTATLTPVATSTHEEIYRVEDASVGLTGFIAVHSTLLGPAAGGLRMRPYASAEEALTDVK
RLSEGMTYKNAAAGLALGGGKAVIIGDPATQKTPELLRAFARAIDSLDGRYITAEDMGMS
PEDMAILAEETTSVAGLADGEYASGDPSPITARGIFNAIRTAWEHKTGQIDLTDRVVSVQ
GLGHVGWYLCDFLNKAGAKLIVTDVNTAQVTRAVEAFGATAVAPDEIYAVEADIFAPCAI
GGILNSDTIPQLKVALVAGGANNQLASSEDAIALHKRGILYAPDFVANGGGIINVATEIQ
KISNRNSFVADRLEALEVTMAAILAQAAADDVSPDAVAIATVQAKMTPKAA