Protein Info for Psest_2053 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized low-complexity proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00805: Pentapeptide" amino acids 40 to 78 (39 residues), 42.9 bits, see alignment 4.1e-15 amino acids 80 to 107 (28 residues), 27.2 bits, see alignment (E = 3.4e-10) amino acids 125 to 164 (40 residues), 33.7 bits, see alignment 3.2e-12 amino acids 165 to 204 (40 residues), 43.6 bits, see alignment 2.6e-15 PF13599: Pentapeptide_4" amino acids 41 to 105 (65 residues), 36.3 bits, see alignment E=8.4e-13 amino acids 120 to 183 (64 residues), 28.4 bits, see alignment E=2.5e-10 amino acids 140 to 204 (65 residues), 28.6 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2272)

Predicted SEED Role

"pentapeptide repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLD2 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Psest_2053 Uncharacterized low-complexity proteins (Pseudomonas stutzeri RCH2)
MKMLSRLLLVLLASPAVFAAEGPLTVNGCTLQPDSQCPNADLRGADLSNQDLRRINLAGA
NLSGANLRHANLDLANLEKADLTGATLNRASLQQANLRLANFTNARLIAVQGWGLFAQAA
QFKGADLTGAYLEFARMSGAKMHGSKLHAADLEMTWLSKADLKGADLTDANLQEAKLNDA
NLADAVLTGARRHYATFQGTNMEGCKDCPHGWEK