Protein Info for HP15_200 in Marinobacter adhaerens HP15

Annotation: peptide ABC transporter, periplasmic peptide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00496: SBP_bac_5" amino acids 81 to 444 (364 residues), 308.6 bits, see alignment E=3.3e-96

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 92% identity to maq:Maqu_0449)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK33 at UniProt or InterPro

Protein Sequence (531 amino acids)

>HP15_200 peptide ABC transporter, periplasmic peptide-binding protein (Marinobacter adhaerens HP15)
MKIPKTATENAMKKLIAAFVGSMALAAAPVALSAEATKELKMAYDADPVTLDIHEQLSGG
ILQLSHMTFDPLLRWTKDLGFEPRLAESWTRVDENTMRFKLREGVKFHSGNELTTADVKF
TFDRLKQSQDFKAIFKPFSGINIIDDYTFELVTSEPYPLLLNTATYIFPFDSEFYSGQTE
DGKDKSAILKHGNSFASENLSGTGPYTVTERKQGVRVEFERFDDYWDTESPGNVGKIVLT
PIKENNTRVSALLSGGVDFIAPVPPNDLERIRNDKSANLVTMSGTRIILFHMNQKRVEAF
KNPKVRQAIAYAINQEGIAAKIMKGFATPAAQMSPEGYQGYNESLTPRFDVAKAQELMKE
AGYEDGFTITMMAPNNRYVNDDKIAQAVAAMLARINIKVDLKTLPKAQYWPEYDNRAADM
MMIGWHADTEDSANFYEFLTFCPDADTGAGQYNAGNYCNPEIDALVQKANVETDLDKRAA
MLQEVEQRLYDDAAFVPLHWQDLAWASKKNVNIEPVLNVMNFPYLGDLVVE