Protein Info for Psest_2050 in Pseudomonas stutzeri RCH2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 297 (284 residues), 58.7 bits, see alignment E=2.5e-20

Best Hits

KEGG orthology group: None (inferred from 58% identity to bpe:BP1682)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMN3 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Psest_2050 Arabinose efflux permease (Pseudomonas stutzeri RCH2)
MPSRLRIVLALGSAQTLAWGSTYYLPAILAEPMASELGISTGNVFAAFSLALIVTAVLGP
LSGKRIDHHGGRDVLALSSIIFAVGLAVLGMASGPLMLWLGWLVIGIGMALGLYESAFST
LTGIFGRDARGAITGITLLAGFASTICWPISGWLNAEYGWRATCLTWAGVHLLLGLPLNR
LLIPVGVQRAMSPAERSQANGRPGSGLTMALLAFVFAATWFTSTAMAAHLPRLLQESGLS
AAAAIGVAALVGPAQVGARCLEFVLLQRFHPLISARLAAIAHPVGAAGVLLAGAPATTAF
VLLHGGGNGILTIAKGTLPLALFGPHGYGLRQGLLMVPARFAQAFAPFVFALLIDDFGTG
ALWLSAALGVLAYVALSLLQRTAQGLG