Protein Info for PGA1_c20350 in Phaeobacter inhibens DSM 17395

Annotation: 5-aminolevulinate synthase HemA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 274 to 297 (24 residues), see Phobius details TIGR01821: 5-aminolevulinic acid synthase" amino acids 4 to 404 (401 residues), 671.8 bits, see alignment E=1.7e-206 PF00155: Aminotran_1_2" amino acids 49 to 392 (344 residues), 224.7 bits, see alignment E=1.1e-70

Best Hits

Swiss-Prot: 81% identical to HEM1_PARDP: 5-aminolevulinate synthase (hemA) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K00643, 5-aminolevulinate synthase [EC: 2.3.1.37] (inferred from 87% identity to rde:RD1_2827)

MetaCyc: 57% identical to 5-aminolevulinate synthase 2 (Cereibacter sphaeroides)
5-aminolevulinate synthase. [EC: 2.3.1.37]

Predicted SEED Role

"5-aminolevulinate synthase (EC 2.3.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.3.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E1V1 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PGA1_c20350 5-aminolevulinate synthase HemA (Phaeobacter inhibens DSM 17395)
MPVDYTAKLDQAIDQLHTEGRYRTFIDIERQNGQFPHAVWTRPDGSKQDITVWCGNDYLG
MGQHPVVLEAMHGAIDATGAGSGGTRNISGTTVYHKQLEAELADLHQKEAALLFTSAYIA
NDATLSTLPKLFPGLIIFSDALNHASMIEGVRRNGGAKRIFRHNDVAHLRELLAAADPAA
PKLIAFESVYSMDGDFGPIAEICDLAEEFGALTYIDEVHAVGMYGARGGGVTERDGLIDR
IDIVNGTLAKAYGVMGGYIAASAKMCDAIRSYAPGFIFTTSLAPAVAAGAAASVAYLKTA
PELREQHQLQARILKMRLKGLGLPIIDHGSHIVPVIVGNPVHTQKLSDMLLSDHGIYVQP
INFPTVPRGTERLRFTPSPVHGPKEIDALVKAMDALWSHCALNRAEMAG