Protein Info for Psest_0201 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details PF00989: PAS" amino acids 19 to 105 (87 residues), 38.7 bits, see alignment E=2.3e-13 TIGR00229: PAS domain S-box protein" amino acids 19 to 112 (94 residues), 51 bits, see alignment E=8e-18 PF13426: PAS_9" amino acids 23 to 108 (86 residues), 36.4 bits, see alignment E=1.3e-12 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 62 bits, see alignment E=1.3e-20 PF00015: MCPsignal" amino acids 333 to 485 (153 residues), 152 bits, see alignment E=3.7e-48

Best Hits

KEGG orthology group: None (inferred from 85% identity to psa:PST_4045)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGC4 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Psest_0201 PAS domain S-box (Pseudomonas stutzeri RCH2)
MRLNLPVSGREVVVGDTANILSTTDLKGTITYANPDFVAISGFSEDELLGQPHNIVRHPD
MPEAAFADLWQTLQANRSWMGMVKNRCKNGDHYWVSAFATPVSRNGKVKEYQSVRTRPQP
EQIRAAEALYAQLRDGRGAPTLRSSVGLRERLALLAAAGAAGGVVVGTVLAASPIAATLA
GLALGGAAAVAAATALLPLSRLARQARQVGDNPVSQLIYTGRRDEIGQIEFAMKMLETEA
GAMVGRIADSSRQLSDHARDLLGAMHGSTQSAARQQQETDLIATAIQQMSASVQEVALNA
QRTAEVAARADSEAAKGREVVGRTGSSITRLAADIQQAAEVIHQLENHSQEISRVLDVIH
GIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRQLASRTSLATTDIQRMIGSLQTGAR
EAVDVMQRSREQAEHSVSHADQAEHSLSGINSRVNEISAMSSQIAAAVDQQSSVGEEISQ
SIVSIRGSSDEHVASGLHSQRNATGVALLADGMLELVQQFWTRRRG