Protein Info for PGA1_c00200 in Phaeobacter inhibens DSM 17395

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 313 to 329 (17 residues), see Phobius details PF01548: DEDD_Tnp_IS110" amino acids 5 to 148 (144 residues), 72.2 bits, see alignment E=4.3e-24 PF02371: Transposase_20" amino acids 215 to 291 (77 residues), 76.1 bits, see alignment E=2.4e-25

Best Hits

KEGG orthology group: None (inferred from 63% identity to pzu:PHZ_c1022)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>PGA1_c00200 transposase (Phaeobacter inhibens DSM 17395)
MDYYVGLDVSLRSVAVCVIDVDGKHIFERSVACEIEDILACLRDVPDGQYRVGFESGAMS
QHLYYGLRNAGLNVVCMEARQVNAALSAMRNKTDKTDARGIAQVLRSGWYGKVFIKSREA
HALRALLSSRKAVQKKCIDLANEVRGLFRVFGLRLPSRVDQGSFDERVRPLIEADPDLSR
ALLPLLDARVMLYKTYRELDRRVKQAASHDEICLRFMAIPGVGPIAALTFRAAVDNPARF
TSSRTVAAHFGLTPRRYQSGEMDNPGRISKAGDSDVRATLYAAANAMMMRAVASSEIKSW
GLRLMRRKGRRRAVVAVARKLAVIMHRMWADNTEFRHGKVEGTV