Protein Info for Psest_0002 in Pseudomonas stutzeri RCH2

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 73.8 bits, see alignment E=1.5e-24 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 480 (475 residues), 631.7 bits, see alignment E=3.8e-194 PF00308: Bac_DnaA" amino acids 147 to 307 (161 residues), 252.9 bits, see alignment E=3.1e-79 PF00004: AAA" amino acids 184 to 301 (118 residues), 26.6 bits, see alignment E=1.5e-09 PF08299: Bac_DnaA_C" amino acids 391 to 459 (69 residues), 111.7 bits, see alignment E=2.8e-36

Best Hits

Swiss-Prot: 87% identical to DNAA_PSEFS: Chromosomal replication initiator protein DnaA (dnaA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 95% identity to psa:PST_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGS0 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Psest_0002 chromosomal replication initiator protein DnaA (Pseudomonas stutzeri RCH2)
MSVELWQQCVELLRDELPAQQFNTWIRPLQVEGDGEELRVYAPNRFVLDWVNEKYLSRLL
ELLSERSSGLAPALSLLIGSKRTSSAALPSAAAARAQPQPTVVSTPAPAAPSPARFEPLS
ADTSEPEQPRVERNVQVEGGLKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGY
NPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRF
YRSVDALLIDDIQFFAKKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIDGLEERLKSR
FGWGLTVAVEPPELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIA
HAHFMGRDITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVAR
PRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAELRETDADIREDYKNLLRTL
TT