Protein Info for PGA1_c20320 in Phaeobacter inhibens DSM 17395

Annotation: Protein-disulfide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF18312: ScsC_N" amino acids 37 to 69 (33 residues), 54.2 bits, see alignment 1.9e-18 PF13462: Thioredoxin_4" amino acids 92 to 246 (155 residues), 58.6 bits, see alignment E=1.9e-19 PF13098: Thioredoxin_2" amino acids 99 to 251 (153 residues), 27.6 bits, see alignment E=6.4e-10 PF01323: DSBA" amino acids 103 to 245 (143 residues), 70.7 bits, see alignment E=3e-23

Best Hits

KEGG orthology group: None (inferred from 70% identity to sit:TM1040_0863)

Predicted SEED Role

"Protein-disulfide isomerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DRM3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PGA1_c20320 Protein-disulfide isomerase (Phaeobacter inhibens DSM 17395)
MTRLTRLPAVSAAALALGLMVAPAVQALDLSKMSDDERAAFGAEVRAYLLENPEVILEAV
NKLEQQQAADEAARDDALVSENLTALHDDGYSWVGGNPNGDITLVEFMDYRCGYCRRAAP
EVEQLVSGDGNIRLIIKEFPILGEASVLTSRFAIATRLVAGDDAYKDVHDALITLSGEPN
EGTLRRLAEGLDLDADAILARMSDPEIARQLQDTRALAQQLAISGTPTFVLGDELLRGYL
PADQMEIMVADIREKRS