Protein Info for Psest_2035 in Pseudomonas stutzeri RCH2

Annotation: crcB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details PF02537: CRCB" amino acids 6 to 119 (114 residues), 98.3 bits, see alignment E=1.4e-32 TIGR00494: protein CrcB" amino acids 7 to 122 (116 residues), 81.3 bits, see alignment E=3.6e-27

Best Hits

Swiss-Prot: 95% identical to CRCB_PSEU5: Putative fluoride ion transporter CrcB (crcB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K06199, CrcB protein (inferred from 95% identity to psa:PST_2290)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GML8 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Psest_2035 crcB protein (Pseudomonas stutzeri RCH2)
MIRMAIAVACGGVVGTLLRFAVATWVSAQWPRHFYFATLAVNLLGCLLIGYLYATFLARP
DISPELRGALIIGFLGALTTFSSFSLDALRLLESGQLATAFAYVGGSVLGGLLAAWAGLM
LARL