Protein Info for PGA1_c20190 in Phaeobacter inhibens DSM 17395

Annotation: two-component signal transduction system, histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details PF17200: sCache_2" amino acids 56 to 199 (144 residues), 92.8 bits, see alignment E=5.3e-30 PF08269: dCache_2" amino acids 84 to 193 (110 residues), 75.8 bits, see alignment E=8.3e-25 PF07730: HisKA_3" amino acids 259 to 327 (69 residues), 45.6 bits, see alignment E=2.1e-15 PF02518: HATPase_c" amino acids 368 to 460 (93 residues), 46.7 bits, see alignment E=9.7e-16

Best Hits

Swiss-Prot: 46% identical to MCTS_RHIL3: Sensor histidine kinase MctS (mctS) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K02480, two-component system, NarL family, sensor kinase [EC: 2.7.13.3] (inferred from 80% identity to sil:SPO2574)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EN67 at UniProt or InterPro

Protein Sequence (477 amino acids)

>PGA1_c20190 two-component signal transduction system, histidine kinase (Phaeobacter inhibens DSM 17395)
MRLIPDFLRPNYAQKLSLLATLPLIVAGAAIAVLVAIQSRALAEREIKALEQQLLQAKKA
ELRNYVTQARNGFSHIYGLAAPDDEEAKEKVTQILSAMIYDRDGFFFVYDYDGTNLVSPR
QTEYINKNWRGLTDSRGTPVVDEFIHLARQGAGWHTFMWEKPSTGEEAQMVAYVLGLQDW
RWAIGTGVFIDDVLASVAASRAEVETRIRRTFYYIGGITLFALGLVFASGMVLNIRERRL
ADAKLKELTQRVFDAQEEERGRVARELHDGISQLLVGVRYALDNARRRLSRGDFDHVDDP
LNKGISHLGTAITEVRRISRDLRPGVLDDLGLGPALKALTDDFAARTGVETRFSTVVFRN
RLDADAKIALYRIAQEALTNIERHAEATEVSMDLRGHARGATMRITDNGRGLPPVQDRGG
PGIGLRNMQERIEQLDGTLRILSSRGTQSGTVIEVLLPLSHLLPPGDAANATSKRVS