Protein Info for Psest_2025 in Pseudomonas stutzeri RCH2

Annotation: cold shock domain protein CspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 TIGR02381: cold shock domain protein CspD" amino acids 1 to 66 (66 residues), 125.6 bits, see alignment E=2.8e-41 PF00313: CSD" amino acids 3 to 65 (63 residues), 93 bits, see alignment E=4e-31

Best Hits

Swiss-Prot: 62% identical to CSPD_VIBCH: Cold shock-like protein CspD (cspD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 95% identity to psa:PST_2300)

Predicted SEED Role

"Cold shock protein CspD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMK5 at UniProt or InterPro

Protein Sequence (86 amino acids)

>Psest_2025 cold shock domain protein CspD (Pseudomonas stutzeri RCH2)
MLSGKVKWFNNAKGYGFIVADGGDEDLFAHYSAIQMEGYRTLKAGQAVMFNILQGPKGLH
ATDIRPQQAMSEATAPAAQGVSTVDA