Protein Info for Psest_2021 in Pseudomonas stutzeri RCH2

Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF02540: NAD_synthase" amino acids 11 to 83 (73 residues), 24.7 bits, see alignment E=3e-09 PF02568: ThiI" amino acids 13 to 81 (69 residues), 23 bits, see alignment E=1.4e-08 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 13 to 364 (352 residues), 463.8 bits, see alignment E=1.6e-143 PF03054: tRNA_Me_trans" amino acids 13 to 207 (195 residues), 273.8 bits, see alignment E=2.2e-85 PF20259: tRNA_Me_trans_M" amino acids 213 to 280 (68 residues), 84.3 bits, see alignment E=8.9e-28 PF20258: tRNA_Me_trans_C" amino acids 290 to 364 (75 residues), 73.2 bits, see alignment E=4.5e-24

Best Hits

Swiss-Prot: 96% identical to MNMA_PSEU5: tRNA-specific 2-thiouridylase MnmA (mnmA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 96% identity to psa:PST_2304)

MetaCyc: 68% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMF7 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Psest_2021 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (Pseudomonas stutzeri RCH2)
MSVTTLTAPEKTRVIVGMSGGVDSSVSALLLLEQGYQVEGLFMKNWEEDDGTEYCTAKED
LADAQAVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDY
ALMLGADLIATGHYVRRRDRDGRSELLKGLDPNKDQSYFLHAVGGEQLGKTLFPVGELEK
PAVRAIAEKYDLATAKKKDSTGICFIGERRFSDFLKQYLPAQPGNIETVDGEVIGRHHGL
MYHTIGQRQGLGIGGLKDASDEPWYVLSKDLQRNALVVGQGNDHPWLFSRALLASEIYWV
NPIDLSTPLKLTAKVRYRQSDQACTLEKTAEGYRAVFEAPQRAVTPGQSVVFYDGEICLG
GGVIEQAEPWFEGRP