Protein Info for Psest_2020 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein involved in purine metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF04356: DUF489" amino acids 6 to 197 (192 residues), 243.3 bits, see alignment E=1.1e-76

Best Hits

Swiss-Prot: 96% identical to HFLD_PSEU5: High frequency lysogenization protein HflD homolog (hflD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 96% identity to psa:PST_2305)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMK1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Psest_2020 Uncharacterized protein involved in purine metabolism (Pseudomonas stutzeri RCH2)
MKALDEQLIALGAVFEAATLVDRIARTGQVPNASLACMLGSLLARNPQTTLEIYGGDDLN
LRDGYRALVGALERDSSTLQREPLRYALAMIGLERQLDKRDDMLQVIGSRLDQIQQQVEH
FGITHENVVASFGGLYQDTLSTFRQRIQVQGDMRHLQQTDNAAKIRALLLSGIRSARLWR
QLGGHRWQLIFSRRKLLDALYPRLRSTQGEDH