Protein Info for Psest_0198 in Pseudomonas stutzeri RCH2

Annotation: TRAP transporter solute receptor, TAXI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 8 to 319 (312 residues), 327.5 bits, see alignment E=3.5e-102 PF16868: NMT1_3" amino acids 32 to 319 (288 residues), 288.3 bits, see alignment E=8.2e-90 PF09084: NMT1" amino acids 110 to 210 (101 residues), 26.5 bits, see alignment E=5.7e-10

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 99% identity to psa:PST_4048)

Predicted SEED Role

"TRAP transporter solute receptor, TAXI family precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHL5 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Psest_0198 TRAP transporter solute receptor, TAXI family (Pseudomonas stutzeri RCH2)
MKGKSLAWIFTAALAGTGLSGVVQAQEKFVTIGTGGQTGVYYVAGQSICRFVNRNAENIK
CNAPASGGGVANVNGLRSGEFNFGIMQSDHQYKAMEGVAPFEKEGKMDDIRAVFSLQSEV
FTVLARRSANIKGLDDLKGKRVNIGNPGSGQRDTLEEIMKVKGWDQSVFSLAAELKPAEQ
ASALGDNNIDAMTYFVGHPNGAIQEATTTTDAVLVPITGPEIDKLLEEKSYYTKAEIPGG
LYKGNDQATQSIGGKAVLSTTSKVDAEVVYQLVKSVFENIERFQRLHPAFKDLKPEEMIE
VGLSAPLHEGAERYYKERGWL