Protein Info for Psest_2012 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 10 to 27 (18 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 263 to 290 (28 residues), see Phobius details amino acids 310 to 341 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 337 (324 residues), 182.7 bits, see alignment E=5.5e-58

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_2313)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKP3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psest_2012 Predicted permease (Pseudomonas stutzeri RCH2)
MVNSTLEQKVFLALLVVVSLAFGWILLPFYGAVFWAVILAIIFAPLQRYLHRRLNQRRNL
AAFVTLLVCLLVAVLPVILTTGMLVQEGATLYKQIESGELDIGSWVARLRDLLPQSVQLQ
LQRFGFGDLESMRERLASGALEGSQFLATKAFSFGQGTFQFLISFFVMLYLLFFFIRDGR
ELVARIRKAIPLSDAQKRRLFNKFTRVVRATVKGNIVVAITQGALGGIIFAVLGISGALL
WGVLMAFLSLLPAVGAGLIWTPVAIYFLMTGAIWQGVVLTLYGILVIGLVDNILRPILVG
KDTKMPDYVVLISTLGGLALFGLNGFVIGPLVAALFISTWGLFTSPEESDMAQLDRASRE
KGPA