Protein Info for Psest_2011 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 26 to 32 (7 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 356 to 382 (27 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details PF13726: Na_H_antiport_2" amino acids 2 to 87 (86 residues), 99.6 bits, see alignment E=9.1e-33 PF03553: Na_H_antiporter" amino acids 150 to 432 (283 residues), 272.9 bits, see alignment E=3.5e-85

Best Hits

Swiss-Prot: 58% identical to Y2115_VIBPA: Uncharacterized membrane protein VP2115 (VP2115) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K07084, (no description) (inferred from 94% identity to psa:PST_2316)

Predicted SEED Role

"Histidine permease YuiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GME9 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Psest_2011 Predicted permease (Pseudomonas stutzeri RCH2)
MNAVVAAVGIMLILSLCRVHVVVALIAGALAGGLIGGLGIEGSLAAFNKGLGGGATVALS
YALLGAFAVAIGKSGLAHALADKALNLVGKQGTQGAGAIKWLMIGLLLAVAVSSQNILPI
HIAFIPLLVPPLLFVLSKMKMDRRLIACVLAFGLITPYMFLPVGFGNIFLNEILLANVAK
SGVDVTGIKVTQAMFIPAMGMVAGLVVAFYSYRKPREYDLARIEQVEKSTVSYSPLTLLV
AAVAVAAAFVIQLWLDSMILGALVGFVIFSVSGVVRWREADDLFTDGMKMMAMIGFIMIA
AAGFAEVMRETGEVKLLVDASTQWIGNSKAVGALLMLLVGLLVTIGIGSSFSTVPIIAAI
FVPLGVELGFSPLAIVSLVGTAGALGDGGSPASDSTLGPTAGLNADGQHNHIWDTVVPTF
LHYNLPLLAFGWLAAMTL