Protein Info for HP15_1924 in Marinobacter adhaerens HP15

Annotation: polysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF02563: Poly_export" amino acids 7 to 81 (75 residues), 85.6 bits, see alignment E=2.1e-28 PF10531: SLBB" amino acids 92 to 140 (49 residues), 42 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 48% identity to cja:CJA_3424)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ08 at UniProt or InterPro

Protein Sequence (182 amino acids)

>HP15_1924 polysaccharide export protein (Marinobacter adhaerens HP15)
MPTATDAQSEPYEIGVGDTVSVHVWRNPELSQTIVVRPDGNISMPLTGDVIAEGKRPEEL
ASEIRVALSELVRSPEVTVMVVNPASKEYRNRVRITGQVEAPQSVAFQPGMTVLDLVLLA
GGLTDFAADGRATLNRQVDGEYKTFGLDLGELISEGNMDFNHVLQPGDVISVPRKQIFRG
EL