Protein Info for PGA1_c02000 in Phaeobacter inhibens DSM 17395

Annotation: glutamate/glutamine/aspartate/asparagine transport system permease protein BztC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 174 (32 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 224 to 318 (95 residues), 55.5 bits, see alignment E=3.4e-19 PF00528: BPD_transp_1" amino acids 240 to 401 (162 residues), 62.3 bits, see alignment E=2.7e-21

Best Hits

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 78% identity to rde:RD1_1446)

Predicted SEED Role

"Glutamate/glutamine/aspartate/asparagine transport system permease protein bztC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIJ4 at UniProt or InterPro

Protein Sequence (432 amino acids)

>PGA1_c02000 glutamate/glutamine/aspartate/asparagine transport system permease protein BztC (Phaeobacter inhibens DSM 17395)
MSDTHAQTVAFVRETQIPPAPPPGRETGVYKWIRENLFSSVPNSILTLAALALIYALLSS
TLPWLLNGVWTTNSLAECREVLDGKLGACFSVLTERWNQLLYGFKYPGTEYWRPNLALVL
LLVALAPVLFFDLPRKLLAFTAIYPFLAFWLIWGGSILVPIVALLGFVAAGFVFQKFGKG
SFALGFFGAIVAAVVVWNIGGFLIPEGASDNAMLSAVPSRDLGGFMLNMMLGVTCVSLSV
PLGIALALGRQSNMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFLRV
VIMITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGIVN
VAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWELLGFAAFLFFIVCYGISQYS
QWLERRLATDHH